.
The Open Protein Structure Annotation Network
PDB Keyword
.

282640

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282640
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19174,TM0770 Molecular Weight 69311.13 Da.
    Residues 599 Isoelectric Point 6.04
    Sequence milkflnetlpwvrkpsryigreinsvvkdpeeislrialvfpdtyevgtsnhgleilyhilneqpdvw aersylpwidmiermkekdiplytmesytplyqmdavgisleyelsytnvvevlklskipiffwerkrr dpivlgggpcssnpepiygffdailigdgeeaileiaqvlketkgeeretiwkelsriegvyvpafyeq kgrkivpvspeyprtikrrivkdlnsqpvpvkkivpnvesvhdravievargctrgcrfchasvyyrpv rerslenilenveemlkntgyeevsllslstmdhtqigeivsellkrysekkiavsipstrmdrfgvei agriasvrktgltfapeaatqrlrniinkniseedifatleaakksgwrrvklyfmmglpgetnedlee mvkllervkrlgfkevsasvsvfvpkphtpfqfarqispeeayekiktlkrakrsarisyhdprmslle gvfsrgdrklldlivkahelgalfdewsemfrfdlwekafdetgidpndylreidpsedfpwdhidmgv tkeflkeeyrkalkgettddcrwnrcylcgvcfrfgvknvlfggerg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch