.
The Open Protein Structure Annotation Network
PDB Keyword
.

282645

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282645
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19178,TM0775 Molecular Weight 77769.93 Da.
    Residues 690 Isoelectric Point 5.44
    Sequence marlrvyelarklnmspkellqeleelgvnvkshmsyvdeemaniiidlleednrkakqpskpkkekge eevekevvekkkkkkitlkpdelkldiiaekigvpqnkiiqdmfvkrgialrpgqilkleeveqilkey kieieieeeqqtsveevdefellekryqelyekekdklvprppvvtvmghvdhgkttlldrirstrvae reeggitqsigayqvevngkkitfidtpghelftemrargaqatdivvlvvaaddgvmpqtieaynhak aanvpiivainkidkpnanvektkqelveklglipeewggdtivvpisartgqgvdellemillvaemn eikcypegparaviieskldkkmgpvasaivkdgvlkvgdavvasntygrvrnlfddnmrpireaypsq pvmilgfedvpdvhsnvyvvesaekakeivekrlqrleaqkqsrkhinleelmkmmqekekkvlnlilk adtygsvaalknainklqskeielnivhagvgeistsdvmlaaavdgvilgfrvkvnnqarrlaeqegv dvrtysiiyklvedlklalegmlepeeveevighgeirkvfkiskvgkvagvqmldgkadrngfvriyr ngqlvfggkieslkhykedvsvveapqecgikfagfddihegdelefyvirkvkrkptfveeqadqeqk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0775
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch