.
The Open Protein Structure Annotation Network
PDB Keyword
.

282672

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282672
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19194,TM0802 Molecular Weight 43837.72 Da.
    Residues 412 Isoelectric Point 5.80
    Sequence mkrvvitgmgivspfgvgkernleglretkvtidrissfdasnlpvqiaaevrdfkpeeyinpklvrrt drfvhfalvsakeavedaginfepyadrtatiigsgmggfltldsennkflsqgpsrvspflipmilid masgvvameyglkgpnfssvsacasslhavalgallirhgyadvavvggteatiaplpitgfanmrals rrnddpkrasrpfdkdrdgfvmgeggavlileaeevaksrgakilaeikgvgmtddayhfsapdpegrg aaeamklalkesslavedidyvschatstpagdeaelkaikkvlgehvknvainsskalighllgaaga selvlailqmqnsfvhgmpnldnpideakgtglvgkepvqmeiknfiknsfgfgghnvsivvgryes
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0802

    Name: 3-hydroxy-palmetoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> 3hpalmACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C14:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + myrsACP + nadp

     
    Name: Fatty acid biosynthesis (n-C24:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : behenACP + h + malACP + nadph --> ACP + co2 + h2o + lgnACP + nadp

     
    Name: Fatty acid biosynthesis (n-C20:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + arachACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C16:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + hdeACP + nadp

     
    Name: Fatty acid biosynthesis (n-C22:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + behenACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + octeACP

     
    Name: 3-hydroxy-octadecanoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> 3hoctaACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C20:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + aracheACP + co2 + h2o + nadp

     
    Name: Acetyl-CoA ACP transacylase
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ACP + accoa --> acACP + coa
    Classification: EC:2.3.1.38
     
    Name: Fatty acid biosynthesis (n-C10:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : actACP + h + malACP + nadph --> ACP + co2 + dcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:2)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + palmACP --> ACP + co2 + h2o + ocdcyaACP

     
    Name: Fatty acid biosynthesis (n-C12:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : dcaACP + h + malACP + nadph --> ACP + co2 + ddcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C14:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + nadp + tdeACP

     
    Name: Fatty acid biosynthesis (n-C16:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + nadp + palmACP

     
    Name: beta-ketoacyl-ACP synthase
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : acACP + h + malACP --> ACP + actACP + co2
    Classification: EC:2.3.1.41
     
    Name: Fatty acid biosynthesis (n-C18:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + ocdcaACP

     
    Name: Fatty acid biosynthesis (n-C22:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0801
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + beheneACP + co2 + h2o + nadp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0802
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch