The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282687
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19208,TM0817, 382643 Molecular Weight 76647.33 Da.
    Residues 674 Isoelectric Point 9.21
    Sequence mrrylftttyvvlvflsffvvfslgkietgpevflpgyngdpekttnenvknlfrvnkefggsssiviv vesdknffedartlyelhraleeredissvmspvnlpklsgfrmdyyfkdekiskdvlndpnaksfite dgkyallnvifkegvnardkipeikrlvssyfeknylfgepvidstlfkelvkqtfvypvfmflvifll fyyqlrsfraaifslivpvlatffvfavffamgkslntmtvmtitflliigsayglhfynalfrfsdkr eavkhifkpilfsmlttaagfmsfvfidirafrelgilvssglavvvlviftsgveifrnytpkrtprs fgmkyvgrkialivlvvflvmaalspfllkrvqvgsdmvsyferdselrkaydlivkkfntrepiylvl eknvpfvgtdskilkeliekiekseyvssvvfpvdipvpimytlsrtnpflktfvgdrnrirlivnltp egyehvkkvvdlinevvsetgwshyvagsvliwndinesimrsqiqsivlasilifamvfiifrrpltt lsvmipiafttvfnflfmalfgisldvstsitsgilmglvidysihiaseerrlrdpylvvknvgpsvl tnalglisgfavllfselalfknisllmmlgigvgaiftlivqpmilekrens
      BLAST   FFAS

    Ligand Information
    Model TM0817
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch