.
The Open Protein Structure Annotation Network
PDB Keyword
.

282689

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282689
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25535,TM0819, 89930, 85019 Molecular Weight 41842.89 Da.
    Residues 399 Isoelectric Point 9.17
    Sequence mefegavtkvsgwrwfllalqhfvamfgatvlvplitgldplvalltagigtlifhfvtggivpvflgs sfafiapilavkeiygdlayatggifvaglfyvlyalivkavgpekvkkilppvvtgsmimvigltlsp vaiqmassdwplaliviatvvfvstmtrgffsmvpvitgvvvgyvaglfmgkidtsvivstplfsvpkv mlpkfdygaifmivpvtlatfmehlgdittngavvgknffdkpglhrtllgdglatavagllggpantt ysentgvlaltrvydpsvlrgaalvaifaafvskfgailqtipqavmggvslilfgmitsvgvrtmvna evdfskprnlmitalmltvgiggavlkvgrvelkgiglaalvgiflnlilpdrd
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0819

    Name: uracil transport via facilated diffusion
    Metabolic Subsystem: Transport
    Reaction: ura[e] <==> ura[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0819

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch