.
The Open Protein Structure Annotation Network
PDB Keyword
.

282753

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282753
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS87186,TM0884 Molecular Weight 52322.17 Da.
    Residues 447 Isoelectric Point 8.38
    Sequence mnvllvnpwihdfaaydfwlkpigllyvaramewmgyevhlvdllnrhdpdlprftrvpkdkrygtgkf psqviekpeilrfvprrykrygappeflewklreignvdlimvtstlsywypgvwetirflkgrydvpi vlggvyprlfpkhakksgaivyekgdlvflprfletlgfpskeipadwfevfdpmyelynrigylvfit tlgcpfrcsycavhrlwnglrvrtpervvetiekylnifkvedvvffddailasgrfkdllklivekrw pvrfhlpngiharlldeetafllkeanfrtiklgyetsgrlqretggkvydedlvraarilrkagftek evsayimvnmpgqtkedvlnaikvclsegigisineytpipgtkdweklveegkldpdidpvflnntvl pfwwkhgmsyeeiqeikdfaqklkksevyrefp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch