.
The Open Protein Structure Annotation Network
PDB Keyword
.

282786

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282786
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25561,TM0917 Molecular Weight 32197.51 Da.
    Residues 309 Isoelectric Point 10.00
    Sequence mfvlllpslflgwslgandaanvfgpfvgsglipyrkativasifvilgsvlggarglqnisslstsdl llssiavlsgaltvtimtklgipvstsqavvggiiganvtvmgiggidfsaltkiltvwfltpvgaffl slifypvlsflfrkipsiqiqdrvikisawiigaygafslgannvanvtgvfagkiltieqaaflggis iaigiltysknvmltvgknlieldhftsliavlsqamvvwifsligihvsssqaivgavlgagyskgmn lgnkkvlikilsgwfltpavsgtlsflltslik
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0917

    Name: phosphate transport in via proton symport
    Other genes that carryout this rxn: TM0261
    Metabolic Subsystem: Transport
    Reaction: h[e] + pi[e] --> h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0917

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch