.
The Open Protein Structure Annotation Network
PDB Keyword
.

282812

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282812
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2176,TM0943, _0061.003249_ Molecular Weight 50032.53 Da.
    Residues 439 Isoelectric Point 5.13
    Sequence mtietikriieeenvrfirlqftdingtlknleitpdvfleswedgimfdgssiegfvrieesdmylkp vldtfavlpwtvdgaksarvicdvytpdgkpfegdpryrlrrmmekaeqlgytpyagpemeffilpine kgepvpefldhggyfdllplskveeirrdiaialekmgitveathhevapsqhevdfrydtflrtadna qtvklviktmaifhgyhatfmpkpfygvngsgmhvhmslfrgdknafydpddplglskelryfvggilk hakalaavtnptinsykrlvpgyeapvyiswsvgnrsaliripkargkatrleyrspdpscniylafaa ilaagldgiinkieppapveeniyhmtserreelnieslpgslkeaveelkkddviidalgehifekfv eaaekdwkefstyvtnwelqrylyl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0943

    Name: glutamine synthetase
    Metabolic Subsystem: Glutamate Metabolism
    Reaction: : atp + glu-L + nh4 --> adp + gln-L + h + pi
    Classification: EC:6.3.1.2
     
    Name: glutamine synthetase (uaaGgla)
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : atp + nh4 + uaaGgla --> adp + h + pi + uaaGgtla

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0943
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch