.
The Open Protein Structure Annotation Network
PDB Keyword
.

282822

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282822
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2178,TM0953 Molecular Weight 33621.00 Da.
    Residues 311 Isoelectric Point 5.70
    Sequence mkvalrktigerllelakqdekivvvtsdargsaaiadffkvfpersievgiaeqtaagvaaglalcgk kawvfgpacfysarnleqikndiaysdanvkivavsggvsygplgsthhalhdvavmraipnlkvllps davlaaaileqllkdekpvymrtgrnpvpviysrdekfevgraitlkegnditiiatgevvwraleaak ilekegisarvidmftvkpldeeavfraaretgrivtveehsifgglggavaeflsqnlptpmkilgip deypvtgtqdevlkhyglapegiaktvlewfkegn
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0953

    Name: transketolase
    Genes involved in rxn:TM1762, TM0953 TM0954
    Other genes that carryout this rxn:TM1762 TM0953+TM0954
    Metabolic Subsystem: Pentose Phosphate Pathway
    Reaction: : e4p + xu5p-D <==> f6p + g3p
    Classification: EC:2.2.1.1
     
    Name: transketolase
    Genes involved in rxn:TM1762, TM0953 TM0954
    Other genes that carryout this rxn:TM1762 TM0953+TM0954
    Metabolic Subsystem: Pentose Phosphate Pathway
    Reaction: : r5p + xu5p-D <==> g3p + s7p
    Classification: EC:2.2.1.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0953
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch