.
The Open Protein Structure Annotation Network
PDB Keyword
.

282824

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282824
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25559,TM0955, 282255 Molecular Weight 35064.75 Da.
    Residues 331 Isoelectric Point 10.08
    Sequence mqversrakiswyqrisryqsifillglivlfsflsnrfltlenfwiilrqtavnlciavgmtfviltg gidlsvgsilgfsgavtakllkyglilsafgvvlkfnplgasiigvlagfaiglfngfiitrfnippfv atlgtmtavrgfimlltkghpitrlgdsfdfigsgwflgipmpvwiaaiatgvgifilrktqfgryvya vggnekaavlsgvnskltklwvyaisgilsavaglivtarldsaqpnaglmyeldaiaatviggaslsg gkgtligtvvgaliigvlndglvlvgvspfwqqvakgfiiiaaviaeklgrgeke
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0955

    Name: D-ribose transport via ABC system
    Other genes that carryout this rxn:TM0959 TM0956 TM0958
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rib-D[e] --> adp[c] + h[c] + pi[c] + rib-D[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0955

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch