.
The Open Protein Structure Annotation Network
PDB Keyword
.

282825

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282825
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19302,TM0956, _0000.000321_, BV1071 Molecular Weight 58542.02 Da.
    Residues 523 Isoelectric Point 5.89
    Sequence mmlntekerevllearnitktfpgviavnnvtlqiykgevcalvgengagkstlmkilagvypdyegqi flegkevrfrnpreaqengialipqeldlvpnlssaeniflsrepvnefgvieyqkmfeqasklfsklg vnidpktkvedlstsqqqmvaiakalsldakiiimdeptsaigkreteqlfniirslknegksviyish rleeifeiadrvvvmrdgrkvgegpieefdhdklvrlmvgrsidqffikeratitdeifrvegiklwsl drkkllvddvsfyvrkgevlgiyglvgagrtelleaifgahpgrtegkvfiggkeikihsprdavkngi glvpedrktaglilqmsvlhnitlpsvvmklivrkfglidsqlekeivrsfieklniktpspyqivenl sggnqqkvvlakwlaikpkvllldeptrgidvnakseiyklisemavsgmgvvmvsselpeilamsdri lvmsegrktaeflreevteedllkaaiprsvkvettqree
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0956

    Name: D-ribose transport via ABC system
    Other genes that carryout this rxn:TM0959 TM0955 TM0958
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rib-D[e] --> adp[c] + h[c] + pi[c] + rib-D[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0956
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch