.
The Open Protein Structure Annotation Network
PDB Keyword
.

282851

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282851
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32921,TM0982, 89957 Molecular Weight 35570.12 Da.
    Residues 332 Isoelectric Point 10.05
    Sequence mvwtglligvlfgvilqrgricfnsafrdvlifkdnylmrlaaltlglesitllifaqagiitlnpkpl nwigniiggfifgmgmvlaggcasgvtyrtgegmttawfaalayaltahatkkglfsgwikwlsnytvt vsntnpvyapktgptiatvlgispwiasiiflalmlwyafgvknksqrpsklnwiaasvliailapiaw wasastgrnyglgitggwinlvsvyannaslnwegaeilgiiigaaisaiagkefklrmpknpktyaqv llggflmgfgavtaggcnighfltgvptlaissivasiffilgnwtmawflfgrqk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0982

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch