.
The Open Protein Structure Annotation Network
PDB Keyword
.

282874

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282874
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19326,TM1005, _0052.000186_ Molecular Weight 34358.24 Da.
    Residues 299 Isoelectric Point 8.32
    Sequence mdefdyvrrklierilhltekqpvvrplpgltvgrresptepstyilppsiciavqgakrvligeeyyv ydvenfllnsfdvpvvaqvieaskekpyigmtweidmeilmeivveqklntrpitssrgtslgkvthql ldafrrmlelldepehisallpvikkeiiyrllvseqgprliqialsgkndvitalnylkehfnesvnm krlaemvgmsvstfyqnfkiltgmtplqyqkklrlcearkllmagsdvttaayqvgyeslsqfsreykr ffgvspsqdakklkeepytrily
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch