.
The Open Protein Structure Annotation Network
PDB Keyword
.

282929

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282929
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19358,TM1062, 89299 Molecular Weight 65679.66 Da.
    Residues 563 Isoelectric Point 5.77
    Sequence mvrpqrnkkrfililngvwnlevtskdrpiavpgswneqyqdlcyeegpftykttfyvpkelsqkhirl yfaavntdcevflngekvgenhieylpfevdvtgkvksgenelrvvvenrlkvggfpskvpdsgthtvg ffgsfppanfdffpyggiirpvlieftdharildiwvdtsesepekklgkvkvkievseeavgqemtik lgeeekkirtsnrfvegefilenarfwsledpylyplkvelekdeytldigirtiswdekrlylngkpv flkgfgkheefpvlgqgtfyplmikdfnllkwinansfrtshypyseewldladrlgilvideaphvgi tryhynpetqkiaednirrmidrhknhpsvimwsvanepesnhpdaegffkalyetanemdrtrpvvmv smmdapdertrdvalkyfdivcvnryygwyiyqgrieeglqalekdieelyarhrkpifvtefgadaia gihydppqmfseeyqaelvektirlllkkdyiigthvwafadfktpqnvrrpilnhkgvftrdrqpklv ahvlrrlwsev
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1062

    Name: beta-glucuronidase (tryptophanyl)
    Metabolic Subsystem: Galactose metabolism
    Reaction: : h2o + trpglcur --> glcur + h + trp-L
    Classification: EC:3.2.1.31
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1062
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch