.
The Open Protein Structure Annotation Network
PDB Keyword
.

282933

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282933
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19364,TM1066, 89987, 89928 Molecular Weight 36730.76 Da.
    Residues 327 Isoelectric Point 8.87
    Sequence mvayilrrlitafitlwiisiisfviiqlppgdfltsyiaqlkvsgedvdiatiealkkqygldkpiyv qylkwlwgilhgdfgysfswkkpvnellwnrlgvtvlvatlslifswifgfiigmysavhpysigdyla tilgyiglavpnfllalilmwgiysltginlsglhsvkylntpmtidkfldilnhlwipvlvlgtsgma glirtlranlldelhkpyveaalskglpenkvfwkyplriamipfistvgwslpwifsgatitaivlnl psvgplllnalknqdmylagslvmflsfftvigtlisdillawvdprirfe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1066

    Name: L-rhamnose transport (ATP-dependent)
    Other genes that carryout this rxn:TM1065 TM1063 TM1064 TM1067
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rmn[e] --> adp[c] + h[c] + pi[c] + rmn[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1066
    generated 12/2008
    Transmembrane protein

    HMM_TM1066

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch