.
The Open Protein Structure Annotation Network
PDB Keyword
.

282934

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282934
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19366,TM1067 Molecular Weight 75925.59 Da.
    Residues 655 Isoelectric Point 5.73
    Sequence mmfrkvlwsllvviftaqilaiglneivpgeyynltdyerltgkkitkfnespmlkemvekgllppvee rlpknpvvvtpyesigkyggtwnrawyglsdewnagricyefmvisdkagksllpdvleslevskdgre ytmrirrglkwsdgepvttkdvefwyhdillnesltpsipsvfqpggkvfkleivddytfkvifeepyp lfpfalagdggragiefvvpshyikkfhpkyigleqaekiakengysswyqfvsdkclqtnswlvnpdl pilfpwklskesseralilernpyyfkvdpegnqlpyidriifhyvenqqmllmkaisgeidmqgrhlt vadysilaanrekggyklilarqavgsadtlminqnytddpvigeilrdprfrqaislavnreeiwqlv yqglgeprqasfvkgvkyydpewekafaeynperanqlldemglkwnpsrtyrlrpdgkkleivieytt psqtrektmemvksylekvgisvilkpidrslyvtrleagqlqigvwefdrnidpvgdpahilgsqwap ltwqwynsgkktgmppeegtdmwklyeiwdqivkevapekrdelmkeiinlhkkniwmvgfvgalpqpi vvkenfknvpqgllwdfplirspknfrpeqfyfe
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1067

    Name: L-rhamnose transport (ATP-dependent)
    Other genes that carryout this rxn:TM1065 TM1066 TM1063 TM1064
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rmn[e] --> adp[c] + h[c] + pi[c] + rmn[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1067
    generated 12/2008
    Transmembrane protein

    HMM_TM1067

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch