.
The Open Protein Structure Annotation Network
PDB Keyword
.

282938

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282938
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19370,TM1071, _0033.000617_ Molecular Weight 44729.86 Da.
    Residues 383 Isoelectric Point 5.43
    Sequence minmerifkeldelkfelpswafsdagtrfavfheegaarnvferiedaalvhrltgccpsvalhipwd kvenweelrefaeekglkigainpnlfqdpdykygsltnpsekirkkaiahvmecvdiaektgskvisl wladgtdypgqddfrsrkkrleeslryiyenmpadmyllieykffepafyhtdipdwgmsyllseklge ralvlvdlghhpqgtnieyivatllsekklggfhlnnrkyadddltiasinpyevflifkeivfakrdp elsdsakkvvlmfdqahitkpkilamiqsvliaqelftkallidenrlreaqknydvveaeeilldafr tdvrpilreyrrqkglpedplrvfreedymekrrrerr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1071

    Name: L-rhamnose isomerase
    Metabolic Subsystem: Rhamnose Metabolism
    Reaction: : rmn <==> rml
    Classification: EC:5.3.1.14
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1071
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch