.
The Open Protein Structure Annotation Network
PDB Keyword
.

282954

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 282954
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32248,TM1087, 305720 Molecular Weight 25927.54 Da.
    Residues 222 Isoelectric Point 9.05
    Sequence mfplydvlpsrkkpyvtialilinvvvfvyelmlndrelllfmyryglvparytvervkealgfsllpf ithmflhggfwhilgnmwflwifgdntedemghvgytlfylsagifaaltqfvftlhsttpmvgasgav sgvmgayfvlfpysrivtlfpifffltlveipafyylmiwffiqvlnglvgsygiawwahiggfvygmi wgyilrmrrihryry
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1087
    generated 12/2008
    Transmembrane protein

    HMM_TM1087

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch