.
The Open Protein Structure Annotation Network
PDB Keyword
.

282955

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282955
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25537,TM1089, 84643 Molecular Weight 54744.19 Da.
    Residues 495 Isoelectric Point 9.11
    Sequence mtstkyrlkvifwyvgqlliwfpailllptifvifypeewiyiesflvpsiisfasgvvlkkvsklnet rvvgyqegavivvttwcaavvlsalpfviegllnfhqavfeatsgwtttgltmfpdveslphvflvwrs vmqfiggagfavimlatligplgaslyssegrvdnilpnvthstkvimviyvayaaagmfflhmagmpw fdafnhsltalatggfsvknasigyygsvsievitivlmllggtgfgihytlwkgnfkafvkngepwim gstiviaslfllrpaekvfhekalryvvfqvvsaitgtgfsnadlvpwvtlfpigvylltvimmlggmm dstagglkqfrvfvtlkliyrsiinfmgprrkvekiivwkgenrktiddgiikdmfvffgvyaltylvg tlilmsygydplvsmfefssamngvglsvgltspnlpvgviwtmtvgmflgrleflvvfyaivriirdv killeerggvns
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1089

    Name: sodium transport (uniport)
    Other genes that carryout this rxn:TM1088
    Metabolic Subsystem: Transport
    Reaction: na1[e] --> na1[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1089

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch