.
The Open Protein Structure Annotation Network
PDB Keyword
.

282962

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282962
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19390,TM1096 Molecular Weight 44513.59 Da.
    Residues 397 Isoelectric Point 5.36
    Sequence mnrvvvglqwgdegkgkvvtylsryhdivarfsgganaghtvnygdfkvihhllpsadftknrgiaigs gvlldpqvlteelrelkekfpdysgeifisesahvvlpvhkemdriidevlkigttkrgigpacadrvm rvnvrvaelgneeklryfleknlslkkiygvdfdaekmmgdlstfyetikdfvvspvqlkrileeksvl fegtqgvlldldvgtypyvtsmncsssgvsagmgfpvevdevlgvfkayttrvgegpfpteltgeegek lrkagheygsttgrprrcgwldlpllryaieisgvdslvmtkadvlngfekikvcvrysdgrdlvslrd lekkepvyevfdgwksledknferfvdfieretgrpvryistgekledivev
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1096

    Name: adenylosuccinate synthase
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : asp-L + gtp + imp --> dcamp + gdp + h + pi
    Classification: EC:6.3.4.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1096
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch