.
The Open Protein Structure Annotation Network
PDB Keyword
.

282987

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282987
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19398,TM1121, 282128 Molecular Weight 34524.47 Da.
    Residues 302 Isoelectric Point 9.83
    Sequence mfpltpyhfsggiklkrvlpyllllptfviitlfiywpavyslrlsfyritpfgnrmvfvglrnfqrlf qspeylnaikvtvvyvlaslfltiflaffialllnmnlpgnrifraliftpyaispaiagvlwsfllnp vvghvnyilsklfglqvewlttkpyaliaviiatvwktlpfdiifylaglqdipqelieaslvegansw artwkivfpllspitfylvimnlvsfmfssfaiidvttkggpgnytttliyrlyldafafqkigpaaaq svilflimaivtifyfkfgerrvhyq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1121

    Name: sn-Glycerol 3-phosphate transport via ABC system
    Other genes that carryout this rxn: TM1122 TM1120
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glyc3p[e] + h2o[c] --> adp[c] + glyc3p[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch