.
The Open Protein Structure Annotation Network
PDB Keyword
.

283002

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283002
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25565,TM1136 Molecular Weight 32107.40 Da.
    Residues 299 Isoelectric Point 10.03
    Sequence mvfflqnlfngimlgglyaliaigytmvygilrlinfahgdvmmmgvyfafyaatllslnplfsaivai lgaallgflidrvaykplrnaprisalitaigvsffleslavvvfgaipksflkvfkdrtilnkvltva gariplltflvifitavilivlffivyrtkigmamraismdipttalmgvnvdavigftfalgsalaaa sgimwamrfpnvhpymgfmpglkafiaavfggigsipgavlggvllglieiflaayfpavmgyrdafaf iiliiillvkpsgllgkkivekv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1136

    Name: L-threonine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1137
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + thr-L[e] --> adp[c] + h[c] + pi[c] + thr-L[c]

     
    Name: L-valine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1137
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + val-L[e] --> adp[c] + h[c] + pi[c] + val-L[c]

     
    Name: L-alanine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1137
    Metabolic Subsystem: Transport
    Reaction: ala-L[e] + atp[c] + h2o[c] --> adp[c] + ala-L[c] + h[c] + pi[c]

     
    Name: L-leucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1137
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + leu-L[e] --> adp[c] + h[c] + leu-L[c] + pi[c]

     
    Name: L-isoleucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1138 TM1135 TM1137
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ile-L[e] --> adp[c] + h[c] + ile-L[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1136

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch