.
The Open Protein Structure Annotation Network
PDB Keyword
.

283027

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283027
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19424,TM1161, 89946 Molecular Weight 50659.57 Da.
    Residues 446 Isoelectric Point 4.75
    Sequence mkikveidlqeliekgdfktlkrvleqqdpadvkemieklppdlkvvvfrllpkdkaaevfselepddq leliklfreerlkeifesmdpddrvelleempanvvkkllsylppqereellyilnypedsaarlatte yvelfedmtvrealekvrkegkkkeniyslmvidrtrklkgtvelrdlivadpdqkvseimnkdpvfvh aiddqelaaelmkkydliilpvvdseerligvitfddlvdvieeeatediqkmasmsatytsyfhtpaw klilkrspwlvvllllesvngniissyekflasipiiaafiptmigsagntgaqisalmirgftlneis lkdwwkvllresligstlglilagvlylraflissdptlnfavatallvlilyanimgallpfiarifk idpafmagpllttivdvtgimiyfyvvhsfls
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1161

    Name: magnesium transport in/out via permease (no H+)
    Other genes that carryout this rxn:TM0561
    Metabolic Subsystem: Transport
    Reaction: mg2[c] <==> mg2[e]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1161
    generated 12/2008
    Transmembrane protein

    HMM_TM1161

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch