.
The Open Protein Structure Annotation Network
PDB Keyword
.

283049

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283049
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19438,TM1184 Molecular Weight 74515.86 Da.
    Residues 643 Isoelectric Point 5.78
    Sequence mkkliwpvllvgtafliiysfligtpleihlatrweialprvlfllgsfllntlfsltgsyvvlfgsvs lflgalmnllefffvypplfyavklifyvagslllligifrvflklkrftlmfrglfeenndmviyydp sgkivdvnpaaerflgytriellgktieeiskpaeekvlfqilnfsqngiktlereflskdgrtilcec klvpvyegkkiamiqeiarpiddirkiedqirkerkrfltyfnnipvlsvilredgtvedvneagckll gvnreqllnknwfdmfhesfphetfersfkekmvhegridgrvirwvfipleenrvmvtglditelken ltslesdkkfyqllldlsksllslgwndfvfkqylsplgevfgsksvalyekkngnfvltaslngsfee ilsripedidcenemlgipleyetetfavlligcgktderlfemarllknyleliywklkgeerilwla erdsltgvynreafenrlaylinlskrynrklsfvfidlddfkrindskghlvgdrvlkefvnrltsll rksdvvgrlggdefgivlpetdrtgaeilmkrieehfrepvlvdgelfsvnfsygisvfpedgesvkel lkvadermymnkfskkrgrenv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1184
    generated 12/2008
    Transmembrane protein

    HMM_TM1184

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch