.
The Open Protein Structure Annotation Network
PDB Keyword
.

283056

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283056
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19442,TM1191, _0022.001151_, 289527 Molecular Weight 37631.51 Da.
    Residues 318 Isoelectric Point 6.00
    Sequence mmelrynpltdewvivsaatqkrpvqpsktecpicvgglelpeeydlvtfenrypslkkdpppvnwkek gpfrkeesrgvcevvvytsdhntalpgmplkqieklvemwvdrtrdlsqhdfvkyififenrgkevgas lphphgqiyafpflpkrievkigamrkwyeekrkcpicevlesegeerkvyetehflalvpfyarfpye vhiypkrhvstllefskeekkefakvlkvvtakydklfdqefpymmmffqapfneedvshffhfhvefn ppkrdrdklkwmasvetgtwafinpvvpeeaarqlretevei
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1191

    Name: galactose-1-phosphate uridylyltransferase
    Other genes that carryout this rxn: TM0896 TM0896
    Metabolic Subsystem: Galactose metabolism
    Reaction: : gal1p + h + utp <==> ppi + udpgal
    Classification: EC:2.7.7.10
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1191
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch