.
The Open Protein Structure Annotation Network
PDB Keyword
.

283058

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283058
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26212,TM1193 Molecular Weight 127975.18 Da.
    Residues 1087 Isoelectric Point 5.55
    Sequence mknmpyewenpqlvsegtekshasfipyldpfsgeweypeefislngnwrflfaknpfevpedffsekf ddsnwdeievpsnwemkgygkpiytnvvypfepnppfvpkddnptgvyrrwieipedwfkkeiflhfeg vrsffylwvngkkigfskdsctpaefrltdvlrpgknlitvevlkwsdgsyledqdmwwfagiyrdvyl yalpkfhirdvfvrtdldenyrngkifldvemrnlgeeeekdlevtlitpdgdektlvketvkpedrvl sfafdvkdpkkwsaetphlyvlklklgedekkvnfgfrkieikdgtllfngkplyikgvnrhefdpdrg havtvermiqdiklmkqhnintvrtshypnqtkwydlcdyfglyvideanieshgidwdpevtlanrwe wekahfdrikrmverdknhpsiifwslgneagdgvnfekaalwikkrdntrlihyegttrrgesyyvdv fslmypkmdilleyaskkrekpfimceyahamgnsvgnlkdywdviekypylhggciwdwvdqgirkkd engrefwayggdfgdtpndgnfcingvvlpdrtpepelyevkkvyqnvkirqvskdtyevenrylftnl emfdgawkirkdgevieektfkifaepgekrllkiplpemddseyfleisfslsedtpwaekghvvawe qfllkapafekksisdgvslredgkhltveakdtvyvfskltglleqilhrrkkilkspvvpnfwrvpt dndignrmpqrlaiwkraskerklfkmhwkkeenrvsvhsvfqlpgnswvyttytvfgngdvlvdlsli paedvpeiprigfqftvpeefgtvewygrgphetywdrkesglfaryrkavgemmhryvrpqetgnrsd vrwfalsdgetklfvsgmpqidfsvwpfsmedlervqhiselperdfvtvnvdfrqmglggddswgamp hleyrllpkpyrfsfrmriseeipswrvlaaipetlhvemssedviregdtlrvkfsllndtplskekq vvlfvdgneysvrrvvippfkkeelvfkveglkkgehlihtnlntrktiyvr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1193

    Name: b-galactosidase
    Other genes that carryout this rxn: TM1195
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : h2o + lcts --> gal + glc-D
    Classification: EC:3.2.1.23
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1193
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch