.
The Open Protein Structure Annotation Network
PDB Keyword
.

283061

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283061
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2232,TM1196, BV1071, _0000.000321_, RER070207000405, 84751, 282235 Molecular Weight 36168.67 Da.
    Residues 319 Isoelectric Point 5.83
    Sequence medtlilknltkvysigsllfrskitavddvsfslkraeiftlagesgcgksttakmilgfeeptsgdi ifegnsiqwwkkrkkdflrkvqavfqnpfesfnplltvddiffetvmnyglansrneaeklideklqlv glkfedingryqselsggqlqrasiarsllsnpslliadepvsmvdaslrmsivnlfaklrdqlgvsvi yithdlatayyvsdriaimfrgnivetgpvdkvlidpkhpytqllresipdpdpekkwsreitvsdtey eeylkegckfagrcpyvkeicrrekpddvlvdgvlvkchiykk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch