.
The Open Protein Structure Annotation Network
PDB Keyword
.

283062

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283062
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19444,TM1197, 89944, 89965 Molecular Weight 32873.56 Da.
    Residues 291 Isoelectric Point 10.21
    Sequence mkqivrvfrdlfrdyrftvafiallfllvlsllsyvspydpvsiyqvprglppsfehpfgtnwlgqdvf wrltfavrnslliavitaffsriiaiivgivsgykggaldqvlmtigdttmvlpilivlivismilkdw arsfvnlglllaffswawdarvirsqvlsvrerdfvrvavlsgmstmkivgkqllphvlpvifttfinn mswaigmeitlaylglgidptvptlgtmlqraitrqalflglwwwlaapivtaillfialywlsvsise yldprarfqrvgvgk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1197

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn: TM1198 TM1199 TM1196 TM1194
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1197
    generated 12/2008
    Transmembrane protein

    HMM_TM1197

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch