.
The Open Protein Structure Annotation Network
PDB Keyword
.

283063

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283063
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19446,TM1198, 289540, 89940 Molecular Weight 38058.62 Da.
    Residues 334 Isoelectric Point 9.18
    Sequence mnfikgyliprllqyfivtflglsaifflprllptdpvkqqlqqyqtfgvyippeqqeemmrtlrqlyg legtlweqyldfwkrlltgdfgpsfsrfpvsvskvisqalpwtvgllslttilswiiavivggivgyyr krwmealdvvvmiirpipyyvmaliclilfayvfpifplsggigigqklsfdletilsivkhgtlpalt lmivgiawqfqsmklivqivksedhvwyaktagvtekmivrnhvirnamlpmitqlglqfggifsgali temvfaypgigwilydaimkadynlimgvmcistiaittsillldliyplfdprvryr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1198

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn:TM1197 TM1199 TM1196 TM1194
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch