.
The Open Protein Structure Annotation Network
PDB Keyword
.

283068

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283068
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19452,TM1203 Molecular Weight 65765.49 Da.
    Residues 577 Isoelectric Point 7.66
    Sequence mknivklflwfllailnialfwagvflfqneyyelsivlfsllvlidffiinprgypyrytipalillf vlvlypiyftfkvaftnygtghfmsrqeaierllydpnfsyvvdstpvsykvfvvydglsptddflilf ktgdtiflgerpkpvvargqevllsqfnlvpitgetislngdtfrivpwpadlseinlvvrgektyksf yspddeilrlnapyfksriaqgylvnaeyvlpdgkklalriapdgewrfmyverlyrlaykeiydgvkm kitttvvnnltgrevveregafydvdengnetflvgfidfvgwknflrivkdpkvsgpffriflwtfvw avlsvvlslavglpfalvlnnprlkgrnlyrtlliipwaipvfisalvwrngllnesygvinkfllplf glepikwfndpfwarvgvllvnvwltfpymmtislgalqsippelyevaaidgagrfrrfvhitfpllm tiiapllvssfafsfnnftiiylitgggppipnsttptgytdilisyvyklafeggqgqdfgfasaisi lifflvggisfvnfklsgafeevsr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1203

    Name: D-glucose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glc-D[e] + h2o[c] --> adp[c] + glc-D[c] + h[c] + pi[c]

     
    Name: Maltotriose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202 TM1837 TM1836 TM1839
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malttr[e] --> adp[c] + h[c] + malttr[c] + pi[c]

     
    Name: maltotetraose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + maltttr[e] --> adp[c] + h[c] + maltttr[c] + pi[c]

     
    Name: maltose transport via ABC system
    Other genes that carryout this rxn:TM1837 TM1836 TM1839 TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + malt[e] --> adp[c] + h[c] + malt[c] + pi[c]

     
    Name: D-galactose transport via ABC system
    Other genes that carryout this rxn:TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + gal[e] + h2o[c] --> adp[c] + gal[c] + h[c] + pi[c]

     
    Name: raffinose transport via ABC system (import)
    Other genes that carryout this rxn:TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + raffin[e] --> adp[c] + h[c] + pi[c] + raffin[c]

     
    Name: melibiose transport via ABC system (import)
    Other genes that carryout this rxn:TM1204 TM1202
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + melib[e] --> adp[c] + h[c] + melib[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1203
    generated 12/2008
    Transmembrane protein

    HMM_TM1203

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch