.
The Open Protein Structure Annotation Network
PDB Keyword
.

283070

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283070
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32908,TM1205 Molecular Weight 17826.35 Da.
    Residues 155 Isoelectric Point 9.88
    Sequence msvfltslilwlvitrfsysellagivvslavslifrkyhgirfdaklplrivryavmflpifiiemvk anidvalrvlnprlplkpgfvelktnlkkdasrlflansitltpgtlsvdvkddrifvhwievksteek eryisgkferlikgvfe
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1205

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch