.
The Open Protein Structure Annotation Network
PDB Keyword
.

283076

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283076
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25543,TM1211, 282248 Molecular Weight 50841.40 Da.
    Residues 466 Isoelectric Point 8.48
    Sequence misllvavpllaafvslfwkkasdvlfslvalfnvivvlskwfpgvveihamgnwkppfginlvlddas fyaalivnliflmvsflpvetkkgyetslmlllgatngfvltgdlfnsfvfmeiititavttaakrenf ynaykylilggiagsfyllatifaygatgslnmahiamvglsgssllavtmlytiglgveaklfplngw vpgvyggnevspivlgtavsfaalymlgrlfgtvfhgsglntlyvlslvtiltgemaalresrllrtfa yssvaqagvvaamiskgtenalnlayfhltndviakfviflvagflvysyrdlngvfrkhkllgisfsm atfslvgfpmfagfqskirmimeafstkdflfpavlliataievgyvirwnvrlwfeeetfeerskvpl tigffsfalaillvvvflqpdvflegtqkmakalldtesyvngvfsavkggm
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1211

    Name: NADH dehydrogenase
    Other genes that carryout this rxn:TM1105 TM1212 TM1214 TM1216 TM0012 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: h[c] + nadh[c] + q[c] --> h[e] + nad[c] + qh2[c]
    Classification: EC:1.6.5.3
     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1211

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch