.
The Open Protein Structure Annotation Network
PDB Keyword
.

283085

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283085
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19462,TM1220, BV1071, _0000.000321_, 89442 Molecular Weight 36684.10 Da.
    Residues 326 Isoelectric Point 6.91
    Sequence migvaevvldvrdlriyyrtlygyvkavdgvsfdikrgeilgiagesgcgkstlgnglillkppmkymg geaildgknimalspkelrkvryekisiipqyamdamnptkkikqiiddllhehgesferkkdvieerl eivnlgkkvlnmypielsggmkqrmvmvistlmnpdvliadeitsaldvssqrsviqmlyemrekeimg slafithdlsvlyqiadkvmvlyagrvaeispmediiqeplhpytkmllsslpkigvrysqtklkgipg yppsllnigpgcrfrdrcpyafekceqdppvfdvdgrkvscwlfergdan
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1220

    Name: mannotriose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + mantr[e] --> adp[c] + h[c] + mantr[c] + pi[c]

     
    Name: oligo-cellulose transport via ABC system
    Other genes that carryout this rxn:TM1221 TM1219 TM1226 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell4[e] + h2o[c] --> adp[c] + cell4[c] + h[c] + pi[c]

     
    Name: oligo-cellulose (6) transport via ABC system
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell6[e] + h2o[c] --> adp[c] + cell6[c] + h[c] + pi[c]

     
    Name: mannobiose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1222 TM1223 TM1221 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manb[e] --> adp[c] + h[c] + manb[c] + pi[c]

     
    Name: mannotetraose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manttr[e] --> adp[c] + h[c] + manttr[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1220
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch