.
The Open Protein Structure Annotation Network
PDB Keyword
.

283086

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283086
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19464,TM1221, 89936, 89985 Molecular Weight 31303.94 Da.
    Residues 282 Isoelectric Point 9.52
    Sequence mtrkefvhfflknkkvifaicvyagliilalvgpylspykdplafvgpgyqppskehwlgtntfgqdif tqlvyglrsslfvgvlggtlatviglligfvagykggwfdellmmftnilmviptlalliiiaaylpyr gvfiesiiigltawpwtaravraqtlslktrefvdlaritarkpmkiifgeimpnmmsyvfmvfilqfg gailaatgldfiglgptrgislgimmqqatlwnaiqlgmwwwaitpgavitlmvatlyvmnagldevfn pklrem
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1221

    Name: Cellobiose transport via ATP transporter
    Other genes that carryout this rxn:TM0028 TM0030 TM0029 TM0027 TM0031 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cellb[e] + h2o[c] --> adp[c] + cellb[c] + h[c] + pi[c]

     
    Name: mannotriose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1226 TM1220 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + mantr[e] --> adp[c] + h[c] + mantr[c] + pi[c]

     
    Name: oligo-cellulose transport via ABC system
    Other genes that carryout this rxn: TM1219 TM1226 TM1220 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell4[e] + h2o[c] --> adp[c] + cell4[c] + h[c] + pi[c]

     
    Name: oligo-cellulose (6) transport via ABC system
    Other genes that carryout this rxn:TM1219 TM1226 TM1220 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell6[e] + h2o[c] --> adp[c] + cell6[c] + h[c] + pi[c]

     
    Name: mannobiose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1220 TM1222 TM1223 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manb[e] --> adp[c] + h[c] + manb[c] + pi[c]

     
    Name: mannotetraose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1226 TM1220 TM1222
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manttr[e] --> adp[c] + h[c] + manttr[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1221
    generated 12/2008
    Transmembrane protein

    HMM_TM1221

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch