.
The Open Protein Structure Annotation Network
PDB Keyword
.

283087

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283087
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25501,TM1222, 89477, 89447 Molecular Weight 37505.56 Da.
    Residues 329 Isoelectric Point 9.55
    Sequence mrkyltkkiliyiltfffavtidwaiprfmpgnpinflisrfaglpesvkvlqsyftqafgldkplweq yinfwkalfrgdlgisiymypqpvakviaralpyslivllpavllsfaignrfgafvarkkrldnfalp vfytltaspyfwfgillawifgvviplfplagaysfgitpsfswdfildflhhwvlpfgslflvmlggw aigmrnmiiyeleanysrylealgssqrlirkyayrnailpqitglaiqlgtvvagaltteivfsypgi gyilmqgilnqdyfliqgcflfiilgvllanflvdifyviidprirksysgev
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1222

    Name: mannotriose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1220
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + mantr[e] --> adp[c] + h[c] + mantr[c] + pi[c]

     
    Name: oligo-cellulose transport via ABC system
    Other genes that carryout this rxn:TM1221 TM1219 TM1226 TM1220
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell4[e] + h2o[c] --> adp[c] + cell4[c] + h[c] + pi[c]

     
    Name: oligo-cellulose (6) transport via ABC system
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1220
    Metabolic Subsystem: Transport
    Reaction: atp[c] + cell6[e] + h2o[c] --> adp[c] + cell6[c] + h[c] + pi[c]

     
    Name: mannobiose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1220 TM1223 TM1221 T
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manb[e] --> adp[c] + h[c] + manb[c] + pi[c]

     
    Name: mannotetraose transport via ABC transporter
    Other genes that carryout this rxn:TM1219 TM1221 TM1226 TM1220
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + manttr[e] --> adp[c] + h[c] + manttr[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM1222

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch