.
The Open Protein Structure Annotation Network
PDB Keyword
.

283092

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283092
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19466,TM1227 Molecular Weight 76927.86 Da.
    Residues 669 Isoelectric Point 4.97
    Sequence mrrfmfillivelsfvlfasdefvkvengkfalngkefrfigsnnyymhyksnrmidsvlesardmgik vlriwgfldgesycrdkntymhpepgvfgvpegisnaqsgferldytvakakelgiklvivlvnnwddf ggmnqyvrwfggthhddfyrdekikeeykkyvsflvnhvntytgvpyreeptimawelaneprcetdks gntlvewvkemssyiksldpnhlvavgdegffsnyegfkpyggeaewayngwsgvdwkkllsietvdfg tfhlypshwgvspenyaqwgakwiedhikiakeigkpvvleeygipksapvnrtaiyrlwndlvydlgg dgamfwmlagigegsdrdergyypdydgfrivnddspeaelireyaklfntgediredtcsfilpkdgm eikktvevragvfdysntfeklsvkvedlvfeneiehlgygiygfdldttripdgehemfleghfqgkt vkdsikakvvnearyvlaeevdfsspeevknwwnsgtwqaefgspdiewngevgngalqlnvklpgksd weevrvarkferlseceileydiyipnveglkgrlrpyavlnpgwvkigldmnnanvesaeiitfggke yrrfhvriefdrtagvkelhigvvgdhlrydgpifidnvrlykrtggm
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1227

    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn:TM0305
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman6
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn:TM0305
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman4 + glcman6
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of galactomannan (extracellular)
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman600 + h2o --> galman4 + galman6
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of galactomannan (extracellular)
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman600 + h2o --> galman4
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of galactomannan (extracellular)
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : galman600 + h2o --> galman6
    Classification: EC:3.2.1.4
     
    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn:TM0305
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman4
    Classification: EC:3.2.1.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1227
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch