.
The Open Protein Structure Annotation Network
PDB Keyword
.

283118

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283118
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19490,TM1253 Molecular Weight 64916.25 Da.
    Residues 576 Isoelectric Point 5.55
    Sequence mkrlrvtlaqlnptlgdfegnlkkaiealrvaedrgsdllvfpelflpgyppedlmlrlsflrenrkyl qkfaqhtrnlgvtvlmgfidsdedaynaaavvkdgeilgvyrkislpnygvfderryfkpgeellvvki gnikvgvticediwnpvepsaslslgegvhlianlsaspyhvgkpvlrkdylsmkaydyhvamaycnmv ggqdelvfdggsmvvdasgevinygklfeeeiitvdldldenlrvslvdprrrymktqnypvktveagn lreksghfepvvnplpvreeemfralitglrdyvrkngfekvviglsggmdsslvaviatealgkenvk gvlmpsmytskesiedaqtlaknlgietfiipitdvfhsyletlkgvfagrepditeenlqarirgnyl malsnkfgwlvlttgnksematgyatlygdmaggfavikdvyktdvyrigrwynswrgkeiipenifvk pptaelrpgqtdqeklppyevldeilrlyieegldpeeiaskgfdrktvldvtemirkneykrkqaaig vkistrafgkdwrmpitnrfkepl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1253

    Name: NAD synthase (nh3)
    Other genes that carryout this rxn:TM0645
    Metabolic Subsystem: NAD Metabolism
    Reaction: : atp + dnad + nh4 --> amp + h + nad + ppi
    Classification: EC:6.3.1.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1253
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch