.
The Open Protein Structure Annotation Network
PDB Keyword
.

283135

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283135
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19508,TM1270, 3.40.640.10 Molecular Weight 42751.04 Da.
    Residues 379 Isoelectric Point 5.74
    Sequence mntddilfsygeediplkalsfpifettnfyfdsfdemskalrngdyefvykrgsnpttrlvekklaal eecedarlvasgmsaislsilhflssgdhvvcvdeayswakkffnylskkfdievsyvppdaeriveai tkktkliylesptsmrmkvidirkvteaagelkiktvidntwaspifqkpkllgvdvvvhsatkyisgh gdvmagviagdvedmknifvdeyknigpvlspieawlilrglrtlelrmkkhyenalvvsdflmdhpkv levnypmnprspqyelassqmsggsglmsfrlktdsaekvkefveslrvfrmavswgshenlvvprvay gdcpkkdvnlirihvglgdpeklvedldqalkki
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1270

    Name: O-succinylhomoserine lyase (H2S)
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : h2s + suchms <==> h + hcys-L + succ
    Classification: EC:4.2.99.9
     
    Name: metb1 (rev)
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : achms + cys-L <==> ac + cyst-L + h
    Classification: EC:4.2.99.9
     
    Name: "O-succinylhomoserine lyase (elimination), reversible"
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : h2o + suchms <==> 2obut + h + nh4 + succ
    Classification: EC:4.2.99.9
     
    Name: O-succinylhomoserine lyase (L-cysteine)
    Other genes that carryout this rxn: TM0882
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : cys-L + suchms --> cyst-L + h + succ
    Classification: EC:4.2.99.9
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1270
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch