The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 283147
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32815,TM1283 Molecular Weight 23184.32 Da.
    Residues 203 Isoelectric Point 10.15
    Sequence mlnfflitiqflsgavmyshiiakikgidlrkirdgnpgssnlwraagwkygfpalmldyfkgtfpiaf fvwnesfhvnryviafaalsgilghafspflkfkggkaiattfgawsvltkwegpmvlgtvftifsilh rlrgknkttpeedafrvmigfaalliytmwkvfngmpelailyfgnflivfykhrlelrrylkgv
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch