.
The Open Protein Structure Annotation Network
PDB Keyword
.

283158

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 283158
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32431,TM1294 Molecular Weight 78569.85 Da.
    Residues 694 Isoelectric Point 9.04
    Sequence mfekytsfvfknrkrifalvlvinilalfglfrlhfttefsilmpqkshqkeiydrmntifksgeqlav mvkmntdplsreglnkvfeikerlssiegvktvitpvpekfpvgfrlvetkgmaekeyedflsyvqsvk dllnvkktddgyyalfmilpeesvppekiekvlsdyehylsgtqyledqifryllfmiftlppfavvll lnvfrvqlgrfkyaifslipagfaalwtlgivmgwfgqdlsiitflvpiftivmgsadglhfvshfler kregettfnavkntlesvgramilttlttmagflsfltlnsesmkqmgvlasigiglagvstwivlpvi lsrvekvepknkesgvfrvfqklskralvvtivsvliflpglfflkadlnilklyksytrvrknvekie evfgralpvyilfesenlfdpsfaqkvlsmeedlkkegfdafsmydiisklnerlfkekgypkilaral ilkrllpdeytenlvsgntgrafvflndldreilvkvenvvekhgfqvtgipyiikemndsivpqqlls vflaismvflllvlfqrsflypakaivpvgislvslfgfmglsgiplnlitanmagivigvgidyaihv telfryygdiektvriastpvlanafglsiglsalilspftfhtylvaimwvtmtvssfmslvilpklleakk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1294
    generated 12/2008
    Transmembrane protein

    HMM_TM1294

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch