.
The Open Protein Structure Annotation Network
PDB Keyword
.

283191

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283191
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19534,TM1328, _0000.000321_, _0000.000765_, BV1071 Molecular Weight 65396.67 Da.
    Residues 571 Isoelectric Point 9.18
    Sequence mkffsasnvrddikkferkykryypifllleslflttnvltpllikktidsafyrgsveevalfsilyf vvlvsqsfimyrlnfsvakhllnasrakeskgvyakiltlplsflnskntgdylsifmrdipkvasgvy larlqfffnlgfflvvlsllfilnvklalvvlasivlffvstsilkkmvirtsqrdqeayqrflkrsre vvegtpvlkqfsgllflrdfldssarewsrasiihstvnelsnrniemnrwvgstivlafgvyllwkge isvgtllafesymnwiydivrmaltglttffstvpnwenftrvfslpferasgidlerfeklqlknvhf kydetpvltglnfeinsgdkiaivarsgagkstlvslfnrllsptegeilingvpieqyslqslrrniv lvrsndilfdttiknnitlfedfpedeienvlkmcecdfvkelengidtvvgergtrlsdgqrqrivla ralirkpqvlildevtsgvdseteekilekilneietviivshrlstikkasriivlndgrveaegthe elmkksplyreivksqlmr
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1328
    generated 12/2008
    Transmembrane protein

    HMM_TM1328

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch