.
The Open Protein Structure Annotation Network
PDB Keyword
.

283205

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283205
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19546,TM1344, 89429, 89465 Molecular Weight 10807.36 Da.
    Residues 90 Isoelectric Point 10.40
    Sequence mvsldpekkneiikefqihendtgsvevqialltarikhltehlrkhpkdfhsrrglmkmigrrrkmlk ylrhkkpevyreliaklgirk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1344
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch