.
The Open Protein Structure Annotation Network
PDB Keyword
.

283236

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283236
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26420,TM1375, 90027, 90120 Molecular Weight 38972.99 Da.
    Residues 336 Isoelectric Point 5.05
    Sequence mmkkvflvllvvlaipifakatlyiynwadyipedvirafeekydcrvvydtyasneemyakfkagggk gydlifpsgdyvsimkkegmlqkldlskipnfkyldkdilakttydpnheysvpymmgstvvivnkkyv keyekswsifdredlrgrmtllddmrevlgaalkylgysvntknpkeleeakqvvlrwkkniakfdass yadgivsgeywvvhgyaedvyqripegeekyfdffipkeggtlwidnmvipkgaknvdlaykfinfile penaakiadylglpspnvearkymqtepiytiedlkncefiedvgealelynkiwleiim
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1375

    Name: putrescine transport via ABC system
    Other genes that carryout this rxn: TM1376 TM1378 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ptrc[e] --> adp[c] + h[c] + pi[c] + ptrc[c]

     
    Name: spermidine transport via ABC system
    Other genes that carryout this rxn: TM1376 TM1378 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + spmd[e] --> adp[c] + h[c] + pi[c] + spmd[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1375
    generated 12/2008
    Transmembrane protein

    HMM_TM1375

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch