.
The Open Protein Structure Annotation Network
PDB Keyword
.

283237

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283237
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26352,TM1376, _0000.000765_, _0000.000321_, RER070207002869, BV1071 Molecular Weight 42044.09 Da.
    Residues 368 Isoelectric Point 5.10
    Sequence miggevsiknvskffddfqvlknvsldikkgeffsilgpsgcgkttllrviagfegvesgdvlldgksi lnlppnkrpvniifqnyalfphltvfeniafplklkklseneinqrvnellslirmeehaqkmpsqlsg gqkqrvaiaralaneprvllldeplsaldaklrqellveldnlhdrvgitfiyvthdqaeaisvsdrva lmnegeivqvgtpyevyespvnvfaatfigetnlmkaevvevedeyyvvespgigqfrcyrdkeakkgd rllitlrpekirisrkqfrseetfnvfhgvvdeeiymghqtkyfvrldegyimkvykqharyildepii kwedevfitwnpddsfivevlee
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1376

    Name: putrescine transport via ABC system
    Other genes that carryout this rxn:TM1375 TM1378 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ptrc[e] --> adp[c] + h[c] + pi[c] + ptrc[c]

     
    Name: spermidine transport via ABC system
    Other genes that carryout this rxn:TM1375 TM1378 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + spmd[e] --> adp[c] + h[c] + pi[c] + spmd[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1376
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch