.
The Open Protein Structure Annotation Network
PDB Keyword
.

283239

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283239
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19574,TM1378, 89381 Molecular Weight 29089.16 Da.
    Residues 256 Isoelectric Point 9.62
    Sequence mkpgrfiktiviltmvffylplfivvlmsfnsakspvwsgftlkwylelftreysvwhafrnslivaiv sstvstaigtltaielfwkksrlensiwfltylpfvvpdviigisllllfsmfkvqlglftitlahitf sipytmmivhsrlqdfdksiieaaydlgstdfqvfyrviipnlvpgivaafllaftlsiddfvitffva gpgsttlpiqiysmirfgisptvnaistfmiagtiligfvlrrfvryif
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1378

    Name: putrescine transport via ABC system
    Other genes that carryout this rxn:TM1375 TM1376 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ptrc[e] --> adp[c] + h[c] + pi[c] + ptrc[c]

     
    Name: spermidine transport via ABC system
    Other genes that carryout this rxn:TM1375 TM1376 TM1377
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + spmd[e] --> adp[c] + h[c] + pi[c] + spmd[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1378
    generated 12/2008
    Transmembrane protein

    HMM_TM1378

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch