.
The Open Protein Structure Annotation Network
PDB Keyword
.

283286

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283286
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19602,TM1426, RER070207002392, 433361 Molecular Weight 72250.54 Da.
    Residues 645 Isoelectric Point 5.56
    Sequence mkiyvdgreviindnernllealknvgieipnlcylseasiygacrmclveingqittsctlkpyegmk vktntpeiyemrrnilelilathnrdcttcdrngscklqkyaedfgirkirfealkkehvrdesapvvr dtskcilcgdcvrvceeiqgvgviefakrgfesvvttafdtplietecvlcgqcvaycptgalsirndi dkliealesdkivigmiapavraaiqeefgidedvamaeklvsflktigfdkvfdvsfgadlvayeeah efyerlkkgerlpqftsccpawvkhaehtypqylqnlssvkspqqalgtvikkiyarklgvpeekiflv sfmpctakkfeaereehegivdivlttrelaqlikmsridinrvepqpfdrpygvssqaglgfgkaggv fscvlsvlneeigiekvdvkspedgirvaevtlkdgtsfkgaviyglgkvkkfleerkdveiievmacn ygcvggggqpypndsrirehrakvlrdtmgikslltpvenlflmklyeedlkdehtrheilhttyrprr rypekdveilpvpngekrtvkvclgtscytkgsyeilkklvdyvkendmegkievlgtfcvencgaspn vivddkiiggatfekvleelskng
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1426

    Name: NAD-linked hydrogenase
    Other genes that carryout this rxn: TM1425 TM1424
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h + nadh <==> h2 + nad
    Classification: EC:1.12.1.2
     
    Name: Official Name Ferredoxin hydrogenase
    Other genes that carryout this rxn: TM1425 TM1424
    Metabolic Subsystem: Energy Metabolism
    Reaction: : fdxr-4:2 + h --> fdxo-4:2 + h2

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1426
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch