The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283289
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19606,TM1429 Molecular Weight 24862.01 Da.
    Residues 234 Isoelectric Point 8.97
    Sequence msvylaeflgtmlliilgdgvvanvvlkkskghnsgwivittgwglavamsvylvgrisgahinpavti glafigqfpwskvpgyifsqilgafvgailvyltylphwketddpdaklavfctgpavrkyganlltei igtmvllmgvlgigankladglnpllvgflvwsiglslggptgyainpardfgprlahailpipgkrds dwsyswvpiigpiiggilgaslynwlf
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1429

    Name: glycerol transport via uniport (facilitated diffusion)
    Metabolic Subsystem: Transport
    Reaction: glyc[e] --> glyc[c]


    Ligand Information
    Model TM1429
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch