.
The Open Protein Structure Annotation Network
PDB Keyword
.

283300

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 283300
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19614,TM1441 Molecular Weight 66491.46 Da.
    Residues 579 Isoelectric Point 5.27
    Sequence mlrthtcgelratdegkkvklcgwvdrirdlggvrfidlrdrygetqivcdvnseaysvvdeltresvv lvegtvrkrpegtenpnietgeievvaerieilsladplpfypgetpkeemrlkyryidlrsermkrni ilryriskiirdyfdelgfleietpfltrstpegardflvpsrlrpgkfyalpqspqlfkqilmisgfd ryfqivrcfrdedlradrqpeftqvdvemsfvdvedvlnvsegmvsrvfkessgidlkvpfdripydda mekygtdkpdrrygmelrdfgyafettefkvirnvlneggsvkgfivpgfasemsrkkgeelmarmkel glggliwfkldggitsphlkhlekefrkiaetenmnegdvcliaahtdrnllnealgtlrleigkehfs hlakgfdvlwvvdfpyfewseeeerfvarhhpftmpvletlgddytkvrakaydlvingyevgggsiri hrrdiqekifellglseeeaqkkfgffleafrygvpphggiafgldrlvsiiagessireviafpktgn gvclltgapaevderqlrelririeeg
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1441

    Name: Aspartyl-tRNA synthetase (Asn)
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : asp-L + atp + trnaasn --> amp + asptrna(asn) + ppi
    Classification: EC:6.1.1.12
     
    Name: Aspartyl-tRNA synthetase
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : asp-L + atp + trnaasp --> amp + asptrna + ppi
    Classification: EC:6.1.1.12
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1441
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch