.
The Open Protein Structure Annotation Network
PDB Keyword
.

283333

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 283333
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2282,TM1475, 89443 Molecular Weight 14431.05 Da.
    Residues 125 Isoelectric Point 10.49
    Sequence marivgvelpnnkkvwvaltyiygigrsrsfeilkntgidpekrvgdltdeeiskitkyiqdhfkvege lrsevernirrlieigcyrgirhklglpvrgqktrsnartrkgprpsriktkkkss
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1475
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch