The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 283340
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19648,TM1483, 89380 Molecular Weight 19124.37 Da.
    Residues 178 Isoelectric Point 10.08
    Sequence metqgvmkeiqyeefeekiieirrtskvtkggknlsfrvvaivgnkngkvglgigkarevpeairkais aakrnivevpvingtiphevigrqdaskvllkpaapgtgiiaggtvravvelagiqniltkslgstnpl nlalatmnglknlldprkvaklrdisveevfkgvrrenna
      BLAST   FFAS

    Ligand Information
    Model TM1483
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch